PDB entry 1cvc

View 1cvc on RCSB PDB site
Description: redesigning the zinc binding site of human carbonic anhydrase II: structure of a his2asp-zn2+ metal coordination polyhedron
Class: hydrolase
Keywords: hydrolase
Deposited on 1993-09-22, released 1994-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918
      • conflict (92)
    Domains in SCOPe 2.03: d1cvca_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cvcA (A:)
    shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
    nghafnvefddsqdkavlkggpldgtyrliqfdfhwgsldgqgsehtvdkkkyaaelhlv
    hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
    gllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
    dnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvcA (A:)
    wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
    afnvefddsqdkavlkggpldgtyrliqfdfhwgsldgqgsehtvdkkkyaaelhlvhwn
    tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
    pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
    rpaqplknrqikasf