PDB entry 1cva

View 1cva on RCSB PDB site
Description: structural and functional importance of a conserved hydrogen bond network in human carbonic anhydrase II
Class: lyase(oxo-acid)
Keywords: lyase(oxo-acid)
Deposited on 1993-02-04, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918
      • conflict (196)
    Domains in SCOPe 2.07: d1cvaa_
  • Heterogens: ZN, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cvaA (A:)
    shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
    nghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlv
    hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
    gllpesldywtypgslvtppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
    dnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvaA (A:)
    wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
    afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
    tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
    pesldywtypgslvtppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
    rpaqplknrqikasf