PDB entry 1cuz

View 1cuz on RCSB PDB site
Description: cutinase, l81g, l182g mutant
Deposited on 1995-11-16, released 1996-07-11
The last revision prior to the SCOP 1.67 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.137
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1cuz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1cuz_ (-)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratggdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctg
    sgivaaphlaygpdargpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cuz_ (-)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratggdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgsgivaaphlaygpdar
    gpapefliekvravrg