PDB entry 1cuo

View 1cuo on RCSB PDB site
Description: crystal structure analysis of isomer-2 azurin from methylomonas j
Deposited on 1999-08-21, released 2000-08-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.175
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cuoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cuoA (A:)
ascettvtsgdtmtystrsisvpascaeftvnfehkghmpktgmghnwvlaksadvgdva
kegahagadnnfvtpgdkrviaftpiigggektsvkfkvsalskdeaytyfcsypghfsm
mrgtlklee