PDB entry 1cul

View 1cul on RCSB PDB site
Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg
Class: Lyase/Lyase/Signaling protein
Keywords: complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme, lyase/hydrolase complex, lyase/lyase/signaling protein
Deposited on 1999-08-20, released 2001-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type v adenylyl cyclase
    Species: Canis lupus familiaris [TaxId:9615]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30803
      • engineered (112)
    Domains in SCOPe 2.07: d1cula_
  • Chain 'B':
    Compound: type II adenylyl cyclase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1culb_
  • Chain 'C':
    Compound: guanine nucleotide-binding protein g(s)
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1culc1, d1culc2
  • Heterogens: MG, CL, GSP, FOK, 103, 3PO, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1culA (A:)
    memkadinakqedmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarf
    dklaaenhclrikilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnm
    rvgihsgrvhcgvlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyeve
    pgcggernaylkehsietflilrctqkrkeekamiak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1culA (A:)
    mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
    ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
    lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
    hsietflil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1culB (B:)
    neelyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsg
    vekiktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfnd
    fklrvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlg
    ytctcrgiinvkgkgdlktyfvntemsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1culB (B:)
    yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
    ktigstymaatglsaerqymhigtmvefayalvgkldainkhsfndfklrvginhgpvia
    gvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgk
    gdlktyfvnt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1culC (C:)
    mgclgnsktedqrneekaqreankkiekqlqkdkqvyrathrllllgagesgkstivkqm
    rilhvngfngdgekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsv
    mnvpdfdfppefyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsd
    qdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqcfndvtaiifvvasssyn
    mvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdllaekvlagkskiedyfpe
    faryttpedatpepgedprvtrakyfirdeflristasgdgrhycyphftcavdtenirr
    vfndcrdiiqrmhlrqyell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1culC (C:)
    athrllllgagesgkstivkqmrilhvgekatkvqdiknnlkeaietivaamsnlvppve
    lanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaqyf
    ldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqcf
    ndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdlla
    ekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgrhy
    cyphftcavdtenirrvfndcrdiiqrm