PDB entry 1cug

View 1cug on RCSB PDB site
Description: cutinase, r17e, n172k mutant
Deposited on 1995-11-16, released 1996-07-11
The last revision prior to the SCOP 1.67 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.142
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1cug__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1cug_ (-)
    lptsnpaqelearqlgettrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctg
    slivaaphlaygpdargpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cug_ (-)
    ettrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs