PDB entry 1cue

View 1cue on RCSB PDB site
Description: cutinase, q121l mutant
Deposited on 1995-11-16, released 1996-07-11
The last revision prior to the SCOP 1.67 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.111
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1cue__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cue_ (-)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggyslgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs