PDB entry 1cud

View 1cud on RCSB PDB site
Description: cutinase, n172k, r196d mutant, monoclinic crystal form with three molecules per asymmetric unit
Deposited on 1995-11-16, released 1996-07-11
The last revision prior to the SCOP 1.67 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.141
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1cuda_
  • Chain 'B':
    Domains in SCOP 1.67: d1cudb_
  • Chain 'C':
    Domains in SCOP 1.67: d1cudc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cudA (A:)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctg
    slivaaphlaygpdaegpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cudA (A:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
    gpapefliekvravrgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cudB (B:)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctg
    slivaaphlaygpdaegpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cudB (B:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
    gpapefliekvravrgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cudC (C:)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctg
    slivaaphlaygpdaegpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cudC (C:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
    gpapefliekvravrgs