PDB entry 1cu1

View 1cu1 on RCSB PDB site
Description: crystal structure of an enzyme complex from hepatitis c virus
Deposited on 1999-08-20, released 2000-08-23
The last revision prior to the SCOP 1.61 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cu1A (A:)
    gsvvivgriilsgsgsitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflat
    cvngvcwtvyhgagsktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlyl
    vtrhadvipvrrrgdsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvaka
    vdfvpvesmettmrspvftdnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvl
    vlnpsvaatlgfgaymskahgidpnirtgvrtittgapvtystygkfladggcsggaydi
    iicdechstdsttilgigtvldqaetagarlvvlatatppgsvtvphpnieevalsntge
    ipfygkaipieairggrhlifchskkkcdelaaklsglginavayyrgldvsviptigdv
    vvvatdalmtgytgdfdsvidcntcvtqtvdfsldptftietttvpqdavsrsqrrgrtg
    rgrrgiyrfvtpgerpsgmfdssvlcecydagcawyeltpaetsvrlraylntpglpvcq
    dhlefwesvftglthidahflsqtkqagdnfpylvayqatvcaraqapppswdqmwkcli
    rlkptlhgptpllyrlgavqnevtlthpitkyimacmsadlevvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cu1B (B:)
    gsvvivgriilsgsgsitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflat
    cvngvcwtvyhgagsktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlyl
    vtrhadvipvrrrgdsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvaka
    vdfvpvesmettmrspvftdnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvl
    vlnpsvaatlgfgaymskahgidpnirtgvrtittgapvtystygkfladggcsggaydi
    iicdechstdsttilgigtvldqaetagarlvvlatatppgsvtvphpnieevalsntge
    ipfygkaipieairggrhlifchskkkcdelaaklsglginavayyrgldvsviptigdv
    vvvatdalmtgytgdfdsvidcntcvtqtvdfsldptftietttvpqdavsrsqrrgrtg
    rgrrgiyrfvtpgerpsgmfdssvlcecydagcawyeltpaetsvrlraylntpglpvcq
    dhlefwesvftglthidahflsqtkqagdnfpylvayqatvcaraqapppswdqmwkcli
    rlkptlhgptpllyrlgavqnevtlthpitkyimacmsadlevvt