PDB entry 1ctz

View 1ctz on RCSB PDB site
Description: mutation of tyrosine-67 in cytochrome c significantly alters the local heme environment
Deposited on 1993-02-15, released 1993-07-15
The last revision prior to the SCOP 1.61 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1ctz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ctz_ (-)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate