PDB entry 1ctx

View 1ctx on RCSB PDB site
Description: three-dimensional structure of the-long-neurotoxin from cobra venom
Deposited on 1982-04-08, released 1982-05-26
The last revision prior to the SCOP 1.71 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1ctx__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ctx_ (-)
  ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
  ncnpfptrkrp