PDB entry 1cto

View 1cto on RCSB PDB site
Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, minimized average structure
Deposited on 1996-09-25, released 1997-10-22
The last revision prior to the SCOP 1.65 freeze date was dated 1997-10-22, with a file datestamp of 1997-10-22.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1cto__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cto_ (-)
    gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
    hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk