PDB entry 1ctj

View 1ctj on RCSB PDB site
Description: crystal structure of cytochrome c6
Class: electron transport
Keywords: cytochrome, electron transport, heme
Deposited on 1995-08-08, released 1996-06-10
The last revision prior to the SCOP 1.75 freeze date was dated 1996-06-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.14
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Monoraphidium braunii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ctja_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ctjA (A:)
    eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
    mpawdgrldedeiagvaayvydqaagnkw