PDB entry 1ctj

View 1ctj on RCSB PDB site
Description: crystal structure of cytochrome c6
Deposited on 1995-08-08, released 1996-06-10
The last revision prior to the SCOP 1.63 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.1397
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1ctj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ctj_ (-)
    eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
    mpawdgrldedeiagvaayvydqaagnkw