PDB entry 1ct8

View 1ct8 on RCSB PDB site
Description: catalytic antibody 7c8 complex
Class: immune system
Keywords: abzyme transition state analog, immune system
Deposited on 1999-08-20, released 1999-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7c8 fab fragment; short chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CT8 (0-213)
    Domains in SCOPe 2.06: d1ct8a1, d1ct8a2
  • Chain 'B':
    Compound: 7c8 fab fragment; long chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CT8 (0-219)
    Domains in SCOPe 2.06: d1ct8b1, d1ct8b2
  • Chain 'C':
    Compound: 7c8 fab fragment; short chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CT8 (0-213)
    Domains in SCOPe 2.06: d1ct8c1, d1ct8c2
  • Chain 'D':
    Compound: 7c8 fab fragment; long chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CT8 (0-219)
    Domains in SCOPe 2.06: d1ct8d1, d1ct8d2
  • Heterogens: SO4, TAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct8A (A:)
    elvmtqtpatlsvtpgdsvslscrasqsvsnklhwyqqkshesprllikfasqsipgips
    rfsgsgsgsdftlsinsvetedfgiyfchqthgrpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct8B (B:)
    qvkllesgavlvkpgasvklscktsgftfsssyinwlkqkpgqslewiawiyagsggtvy
    nqhftdkarltvdtssstaymqfsslttedsaiyycaryrydegfaywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct8C (C:)
    elvmtqtpatlsvtpgdsvslscrasqsvsnklhwyqqkshesprllikfasqsipgips
    rfsgsgsgsdftlsinsvetedfgiyfchqthgrpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct8D (D:)
    qvkllesgavlvkpgasvklscktsgftfsssyinwlkqkpgqslewiawiyagsggtvy
    nqhftdkarltvdtssstaymqfsslttedsaiyycaryrydegfaywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc