PDB entry 1ct8

View 1ct8 on RCSB PDB site
Description:
Deposited on 1999-08-20, released 1999-11-10
The last revision prior to the SCOP 1.57 freeze date was dated 1999-11-10, with a file datestamp of 1999-11-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1ct8a1, d1ct8a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1ct8b1, d1ct8b2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1ct8c1, d1ct8c2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1ct8d1, d1ct8d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct8A (A:)
    elvmtqtpatlsvtpgdsvslscrasqsvsnklhwyqqkshesprllikfasqsipgips
    rfsgsgsgsdftlsinsvetedfgiyfchqthgrpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct8B (B:)
    qvkllesgavlvkpgasvklscktsgftfsssyinwlkqkpgqslewiawiyagsggtvy
    nqhftdkarltvdtssstaymqfsslttedsaiyycaryrydegfaywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct8C (C:)
    elvmtqtpatlsvtpgdsvslscrasqsvsnklhwyqqkshesprllikfasqsipgips
    rfsgsgsgsdftlsinsvetedfgiyfchqthgrpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct8D (D:)
    qvkllesgavlvkpgasvklscktsgftfsssyinwlkqkpgqslewiawiyagsggtvy
    nqhftdkarltvdtssstaymqfsslttedsaiyycaryrydegfaywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc