PDB entry 1csy

View 1csy on RCSB PDB site
Description: syk tyrosine kinase c-terminal sh2 domain complexed with a phosphopeptidefrom the gamma chain of the high affinity immunoglobin g receptor, nmr
Deposited on 1995-10-03, released 1996-11-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1csya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1csyA (A:)
  gsrrasvgshekmpwfhgkisreeseqivligsktngkflirardnngsyalcllhegkv
  lhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltvpcqkigtq