PDB entry 1csk

View 1csk on RCSB PDB site
Description: the crystal structure of human csksh3: structural diversity near the rt-src and n-src loop
Deposited on 1994-03-22, released 1994-07-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1cska_
  • Chain 'B':
    Domains in SCOP 1.61: d1cskb_
  • Chain 'C':
    Domains in SCOP 1.61: d1cskc_
  • Chain 'D':
    Domains in SCOP 1.61: d1cskd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cskA (A:)
gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cskB (B:)
gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cskC (C:)
gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cskD (D:)
gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr