PDB entry 1cs3

View 1cs3 on RCSB PDB site
Description: structure of btb/poz transcription repression domain from promelocytic leukemia zinc finger oncoprotein
Class: transcription
Keywords: btb/poz, plzf, transcription repression, oncoprotein, gene regulation, transcription
Deposited on 1999-08-16, released 1999-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc finger protein plzf
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cs3a_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cs3A (A:)
    gmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhrn
    sqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkml