PDB entry 1cs3

View 1cs3 on RCSB PDB site
Description: structure of btb/poz transcription repression domain from promelocytic leukemia zinc finger oncoprotein
Deposited on 1999-08-16, released 1999-08-27
The last revision prior to the SCOP 1.69 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1cs3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cs3A (A:)
    gmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhrn
    sqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkml