PDB entry 1cri

View 1cri on RCSB PDB site
Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c
Class: electron transport(cytochrome)
Keywords: electron transport(cytochrome)
Deposited on 1993-08-06, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c
  Species: Saccharomyces cerevisiae
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • conflict (56)
    • conflict (71)
    • conflict (106)
  Domains in SCOP 1.75: d1cria_
• Heterogens: SO4, TML, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1criA (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
  nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate