PDB entry 1crh

View 1crh on RCSB PDB site
Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c
Deposited on 1993-08-06, released 1994-01-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.65: d1crh__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1crh_ (-)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace