PDB entry 1cre

View 1cre on RCSB PDB site
Description: cardiotoxin II from taiwan cobra venom, naja naja atra: structure in solution and comparision among homologous cardiotoxins
Class: cardiotoxin
Keywords: cardiotoxin
Deposited on 1994-03-12, released 1994-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cardiotoxin II
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1crea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1creA (A:)
    lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn