PDB entry 1cqy

View 1cqy on RCSB PDB site
Description: starch binding domain of bacillus cereus beta-amylase
Deposited on 1999-08-12, released 1999-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-20, with a file datestamp of 1999-08-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cqya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqyA (A:)
    tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
    niefkafikskdgtvkswqtiqqswnpvplkttshtssw