PDB entry 1cqv

View 1cqv on RCSB PDB site
Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.0
Class: toxin
Keywords: enterotoxin, superantigen, zinc binding, immune system
Deposited on 1999-08-11, released 1999-08-22
The last revision prior to the SCOP 1.73 freeze date was dated 2001-09-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (staphylococcal enterotoxin c2)
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1cqva1, d1cqva2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cqvA (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqvA (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegnhfdngn
    lqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgyik
    fienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng