PDB entry 1cqu

View 1cqu on RCSB PDB site
Description: solution structure of the n-terminal domain of ribosomal protein l9
Class: ribosome
Keywords: protein l9, nmr, ribosome
Deposited on 1999-08-11, released 2002-04-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L9
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1cqua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cquA (A:)
    mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqr