PDB entry 1cqn

View 1cqn on RCSB PDB site
Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Deposited on 1999-08-08, released 2000-09-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-08, with a file datestamp of 2000-09-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cqna_
  • Chain 'B':
    Domains in SCOP 1.55: d1cqnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqnA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqnB (B:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl