PDB entry 1cqm

View 1cqm on RCSB PDB site
Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Class: ribosomal protein
Keywords: alzheimer disease, ribosomal protein s6, oligomerization
Deposited on 1999-08-08, released 2000-09-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.247
AEROSPACI score: -1.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s6
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23370 (0-End)
      • engineered mutation (40-41)
    Domains in SCOP 1.75: d1cqma_
  • Chain 'B':
    Compound: ribosomal protein s6
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23370 (0-End)
      • engineered mutation (40-41)
    Domains in SCOP 1.75: d1cqmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cqmA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqmA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cqmB (B:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqmB (B:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl