PDB entry 1cqk

View 1cqk on RCSB PDB site
Description: crystal structure of the ch3 domain from the mak33 antibody
Deposited on 1999-08-06, released 1999-08-31
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-11, with a file datestamp of 1999-09-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cqka_
  • Chain 'B':
    Domains in SCOP 1.55: d1cqkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cqkA (A:)
paapqvytipppleqmakdlvsltcmitdffpeditvewqwngqpaenykntqpimdtdg
syfvysklnvqksnweagntftcsvlheglhnhhtekslsh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cqkB (B:)
paapqvytipppleqmakdlvsltcmitdffpeditvewqwngqpaenykntqpimdtdg
syfvysklnvqksnweagntftcsvlheglhnhhtekslsh