PDB entry 1cqi

View 1cqi on RCSB PDB site
Description: Crystal Structure of the Complex of ADP and MG2+ with Dephosphorylated E. Coli Succinyl-CoA Synthetase
Class: ligase
Keywords: ATP-grasp fold, rossmann fold, ligase
Deposited on 1999-08-06, released 2000-01-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.191
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (succinyl-coa synthetase alpha chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1cqia1, d1cqia2
  • Chain 'B':
    Compound: protein (succinyl-coa synthetase beta chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1cqib1, d1cqib2
  • Chain 'D':
    Compound: protein (succinyl-coa synthetase alpha chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1cqid1, d1cqid2
  • Chain 'E':
    Compound: protein (succinyl-coa synthetase beta chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1cqie1, d1cqie2
  • Heterogens: MG, PO4, COA, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqiA (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqiB (B:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaav
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqiD (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqiE (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaav