PDB entry 1cqh

View 1cqh on RCSB PDB site
Description: high resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human ref-1 (residues 59-71 of the p50 subunit of nfkb), nmr, minimized average structure
Class: complex (electron transport/peptide)
Keywords: complex, electron transport/peptide, complex (electron transport/peptide) complex
Deposited on 1996-04-02, released 1996-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (1-104)
      • engineered (34)
      • engineered (61)
      • engineered (68)
      • engineered (72)
      • conflict (73)
    Domains in SCOPe 2.06: d1cqha_
  • Chain 'B':
    Compound: ref-1 peptide
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqhA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
    daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'B':
    No sequence available.