PDB entry 1cqh

View 1cqh on RCSB PDB site
Description: high resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human ref-1 (residues 59-71 of the p50 subunit of nfkb), nmr, minimized average structure
Class: complex (electron transport/peptide)
Keywords: complex, electron transport/peptide, complex (electron transport/peptide) complex
Deposited on 1996-04-02, released 1996-08-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Homo sapiens [TaxId:9606]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10599 (1-104)
    • engineered (34)
    • engineered (61)
    • engineered (68)
    • engineered (72)
    • conflict (73)
  Domains in SCOPe 2.05: d1cqha_
• Chain 'B':
  Compound: ref-1 peptide
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27695 (0-12)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cqhA (A:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
  daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv
  

  
  
• Chain 'B':
  No sequence available.