PDB entry 1cpi

View 1cpi on RCSB PDB site
Description: regioselective structural and functional mimicry of peptides. design of hydrolytically stable cyclic peptidomimetic inhibitors of hiv-1 protease
Deposited on 1995-10-16, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.163
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cpia_
  • Chain 'B':
    Domains in SCOP 1.55: d1cpib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cpiA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cpiA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cpiB (B:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cpiB (B:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf