PDB entry 1cp6

View 1cp6 on RCSB PDB site
Description: 1-butaneboronic acid binding to aeromonas proteolytica aminopeptidase
Deposited on 1999-06-08, released 1999-06-17
The last revision prior to the SCOP 1.59 freeze date was dated 2000-01-19, with a file datestamp of 2000-01-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1cp6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cp6A (A:)
    mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
    pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
    giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
    tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
    ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg