PDB entry 1cp3

View 1cp3 on RCSB PDB site
Description: crystal structure of the complex of apopain with the tetrapeptide inhibitor ace-dvad-fmc
Deposited on 1996-12-12, released 1997-12-24
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cp3a_
  • Chain 'B':
    Domains in SCOP 1.55: d1cp3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cp3A (A:)
    nsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltre
    eivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltgk
    pklfiiqacrgteldcgietdsgvdddmachkipvdadflyaystapgyyswrnskdgsw
    fiqslcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkely
    fyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cp3A (A:)
    nsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltre
    eivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltgk
    pklfiiqacrgteldcgiehkipvdadflyaystapgyyswrnskdgswfiqslcamlkq
    yadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfyh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cp3B (B:)
    nsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltre
    eivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltgk
    pklfiiqacrgteldcgietdsgvdddmachkipvdadflyaystapgyyswrnskdgsw
    fiqslcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkely
    fyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cp3B (B:)
    nsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltre
    eivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltgk
    pklfiiqacrgteldcgiehkipvdadflyaystapgyyswrnskdgswfiqslcamlkq
    yadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfyh