PDB entry 1cp0

View 1cp0 on RCSB PDB site
Description: recombinant sperm whale myoglobin l104n mutant (met)
Deposited on 1999-06-07, released 1999-06-14
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-14, with a file datestamp of 1999-06-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.14
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cp0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cp0A (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikynefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg