PDB entry 1coz

View 1coz on RCSB PDB site
Description: ctp:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis
Deposited on 1999-05-29, released 1999-10-06
The last revision prior to the SCOP 1.57 freeze date was dated 1999-10-06, with a file datestamp of 1999-10-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1coza_
  • Chain 'B':
    Domains in SCOP 1.57: d1cozb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cozA (A:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeei
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cozB (B:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeei