PDB entry 1cor

View 1cor on RCSB PDB site
Description:
Deposited on 1993-06-23, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1cor__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cor_ (-)
    edgealfkskpcaachsidaklvgpafkevaakyagqdgaadllaghikngsqgvwgpip
    mppnpvteeeakilaewilsqk