PDB entry 1cnv

View 1cnv on RCSB PDB site
Description: crystal structure of concanavalin b at 1.65 a resolution
Deposited on 1995-02-20, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.172
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1cnv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cnv_ (-)
    dissteiavywgqredgllrdtcktnnykivfisfldkfgceirkpelelegvcgpsvgn
    pcsflesqikecqrmgvkvflalggpkgtysacsadyakdlaeylhtyflserregplgk
    valdgihfdiqkpvdelnwdnlleelyqikdvyqstfllsaapgclspdeyldnaiqtrh
    fdyifvrfyndrscqystgniqrirnawlswtksvyprdknlflelpasqatapgggyip
    psaligqvlpylpdlqtryagialwnrqadketgystniiryl