PDB entry 1cnv

View 1cnv on RCSB PDB site
Description: crystal structure of concanavalin b at 1.65 a resolution
Class: seed protein
Keywords: plant chitinase, chitin binding protein, seed protein
Deposited on 1995-02-20, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.172
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin b
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cnva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cnvA (A:)
    dissteiavywgqredgllrdtcktnnykivfisfldkfgceirkpelelegvcgpsvgn
    pcsflesqikecqrmgvkvflalggpkgtysacsadyakdlaeylhtyflserregplgk
    valdgihfdiqkpvdelnwdnlleelyqikdvyqstfllsaapgclspdeyldnaiqtrh
    fdyifvrfyndrscqystgniqrirnawlswtksvyprdknlflelpasqatapgggyip
    psaligqvlpylpdlqtryagialwnrqadketgystniirylnatampftsnllkyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnvA (A:)
    dissteiavywgqredgllrdtcktnnykivfisfldkfgceirkpelelegvcgpsvgn
    pcsflesqikecqrmgvkvflalggpkgtysacsadyakdlaeylhtyflserregplgk
    valdgihfdiqkpvdelnwdnlleelyqikdvyqstfllsaapgclspdeyldnaiqtrh
    fdyifvrfyndrscqystgniqrirnawlswtksvyprdknlflelpasqatapgggyip
    psaligqvlpylpdlqtryagialwnrqadketgystniiryl