PDB entry 1cns

View 1cns on RCSB PDB site
Description: crystal structure of chitinase at 1.91a resolution
Deposited on 1995-06-24, released 1996-01-29
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-02, with a file datestamp of 1999-12-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1cnsa_
  • Chain 'B':
    Domains in SCOP 1.67: d1cnsb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cnsA (A:)
    svssivsraqfdrmllhrndgacqakgfytydafvaaaaafsgfgttgsadvqkrevaaf
    laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
    hnynygpagraigvdllanpdlvatdatvsfktamwfwmtaqppkpsshavivgqwspsg
    adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
    pfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cnsB (B:)
    svssivsraqfdrmllhrndgacqakgfytydafvaaaaafsgfgttgsadvqkrevaaf
    laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
    hnynygpagraigvdllanpdlvatdatvsfktamwfwmtaqppkpsshavivgqwspsg
    adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
    pfa