PDB entry 1cnh

View 1cnh on RCSB PDB site
Description: x-ray crystallographic studies of engineered hydrogen bond networks in a protein-zinc binding site
Class: lyase (oxo-acid)
Keywords: lyase (oxo-acid)
Deposited on 1995-04-03, released 1995-07-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.158
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-258)
      • conflict (90)
    Domains in SCOPe 2.03: d1cnha_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cnhA (A:)
    shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
    nghafnvefddsqdkavlkggpldgtyrliefhfhwgsldgqgsehtvdkkkyaaelhlv
    hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
    gllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
    dnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cnhA (A:)
    hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
    hafnvefddsqdkavlkggpldgtyrliefhfhwgsldgqgsehtvdkkkyaaelhlvhw
    ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
    lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
    wrpaqplknrqikasfk