PDB entry 1cn3

View 1cn3 on RCSB PDB site
Description: interaction of polyomavirus internal protein vp2 with major capsid protein vp1 and implications for participation of vp2 in viral entry
Class: Viral protein
Keywords: VIRAL COAT PROTEIN VP1, VIRAL COAT PROTEIN VP2, VIRAL ENTRY, Viral protein
Deposited on 1999-05-24, released 1999-06-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein vp1
    Species: Polyomavirus [TaxId:10624]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cn3a_
  • Chain 'B':
    Compound: coat protein vp1
    Species: Polyomavirus [TaxId:10624]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cn3b_
  • Chain 'C':
    Compound: coat protein vp1
    Species: Polyomavirus [TaxId:10624]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cn3c_
  • Chain 'D':
    Compound: coat protein vp1
    Species: Polyomavirus [TaxId:10624]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cn3d_
  • Chain 'E':
    Compound: coat protein vp1
    Species: Polyomavirus [TaxId:10624]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cn3e_
  • Chain 'F':
    Compound: fragment of coat protein vp2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn3A (A:)
    mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn
    tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
    stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
    akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
    kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn3B (B:)
    mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn
    tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
    stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
    akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
    kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn3C (C:)
    mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn
    tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
    stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
    akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
    kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn3D (D:)
    mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn
    tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
    stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
    akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
    kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cn3E (E:)
    mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn
    tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
    stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
    akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
    kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'F':
    No sequence available.