PDB entry 1cmo

View 1cmo on RCSB PDB site
Description: immunoglobulin motif DNA-recognition and heterodimerization for the pebp2/cbf runt-domain
Class: transcription
Keywords: transcription factor, hematopoiesis, osteogenesis, ig-fold, nmr
Deposited on 1999-05-11, released 2000-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: polyomavirus enhancer binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01196 (0-126)
    • see remark 999 (29)
  Domains in SCOPe 2.07: d1cmoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cmoA (A:)
  vevladhpgelvrtdspnflcsvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagnde
  nysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvd
  gpreprr