PDB entry 1cmk

View 1cmk on RCSB PDB site
Description: crystal structures of the myristylated catalytic subunit of camp-dependent protein kinase reveal open and closed conformations
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1993-11-18, released 1994-05-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.233
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    Species: Sus scrofa
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (0-349)
      • conflict (62)
      • conflict (68)
      • conflict (107)
      • conflict (285)
    Domains in SCOP 1.73: d1cmke_
  • Chain 'I':
    Compound: cAMP-dependent protein kinase inhibitor, alpha form
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, MYR

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cmkE (E:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khketgnhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    No sequence available.