PDB entry 1cly

View 1cly on RCSB PDB site
Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester
Class: immunoglobulin
Keywords: immunoglobulin, immunoglobulin c region, glycoprotein, antib
Deposited on 1995-03-15, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg fab (human igg1, kappa)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CLY (0-218)
    Domains in SCOPe 2.07: d1clyh1, d1clyh2
  • Chain 'L':
    Compound: igg fab (human igg1, kappa)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CLY (Start-218)
    Domains in SCOPe 2.07: d1clyl1, d1clyl2
  • Heterogens: NON

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clyH (H:)
    evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
    pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsva
    stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1clyL (L:)
    dvlmtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1clyL (L:)
    lmtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrfsg
    vpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikrtvaapsvfi
    fppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslss
    tltlskadyekhkvyacevthqglsspvtksfnrgec