PDB entry 1clo

View 1clo on RCSB PDB site
Description: anti-carcinoembryonic antigen monoclonal antibody a5b7
Deposited on 1996-05-01, released 1997-05-15
The last revision prior to the SCOP 1.63 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cloH (H:)
    evklvesggglvqpggslrlscatsgftftdyymnwvrqppgkalewlgfignkangytt
    eysasvkgrftisrdksqsilylqmntlraedsatyyctrdrglrfyfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cloL (L:)
    qtvlsqspailsaspgekvtmtcrasssvtyihwyqqkpgsspkswiyatsnlasgvpar
    fsgsgsgtsysltisrveaedaatyycqhwsskpptfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec