PDB entry 1clm

View 1clm on RCSB PDB site
Description: structure of paramecium tetraurelia calmodulin at 1.8 angstroms resolution
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-01-23, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Paramecium tetraurelia [TaxId:5888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1clma_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1clmA (A:)
    aqelteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltdde
    vdemireadidgdghinyeefvrmmvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1clmA (A:)
    lteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
    dfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddevde
    mireadidgdghinyeefvrmmvs