PDB entry 1clc

View 1clc on RCSB PDB site
Description: three-dimensional structure of endoglucanase d at 1.9 angstroms resolution
Deposited on 1995-01-19, released 1995-06-03
The last revision prior to the SCOP 1.55 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1clc_ (-)
    ietkvsaakitenyqfdsrirlnsigfipnhskkatiaancstfyvvkedgtivytgtat
    smfdndtketvyiadfssvneegtyylavpgvgksvnfkiamnvyedafktamlgmyllr
    cgtsvsatyngihyshgpchtndayldyingqhtkkdstkgwhdagdynkyvvnagitvg
    smflawehfkdqlepvaleipeknnsipdfldelkyeidwiltmqypdgsgrvahkvstr
    nfggfimpenehderffvpwssaatadfvamtamaarifrpydpqyaekcinaakvsyef
    lknnpanvfanqsgfstgeyatvsdaddrlwaaaemwetlgdeeylrdfenraaqfskki
    eadfdwdnvanlgmftyllserpgknpalvqsikdsllstadsivrtsqnhgygrtlgtt
    yywgcngtvvrqtmilqvankispnndyvnaaldaishvfgrnyynrsyvtglginppmn
    phdrrsgadgiwepwpgylvgggwpgpkdwvdiqdsyqtneiainwnaaliyalagfvny
    n