PDB entry 1ckh

View 1ckh on RCSB PDB site
Description: t70v mutant human lysozyme
Deposited on 1999-04-22, released 1999-04-30
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-15, with a file datestamp of 1999-12-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ckha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ckhA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgkvpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv